Icon representing a puzzle

2337: Revisiting Puzzle 90: Heliomicin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for NKSA 11. NKSA 1 pt. 7,520
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for Ilya 41. Ilya Lv 1 2 pts. 9,093
  2. Avatar for Simek 42. Simek Lv 1 2 pts. 9,049
  3. Avatar for johngran 43. johngran Lv 1 2 pts. 9,048
  4. Avatar for Merf 44. Merf Lv 1 2 pts. 8,983
  5. Avatar for carxo 45. carxo Lv 1 1 pt. 8,954
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 1 pt. 8,908
  7. Avatar for Oransche 47. Oransche Lv 1 1 pt. 8,855
  8. Avatar for abskebabs 48. abskebabs Lv 1 1 pt. 8,847
  9. Avatar for Steven Pletsch 49. Steven Pletsch Lv 1 1 pt. 8,814
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 8,797

Comments