Icon representing a puzzle

2337: Revisiting Puzzle 90: Heliomicin

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for NKSA 11. NKSA 1 pt. 7,520
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0

  1. Avatar for hada 51. hada Lv 1 1 pt. 8,750
  2. Avatar for badgoes 52. badgoes Lv 1 1 pt. 8,742
  3. Avatar for pfirth 53. pfirth Lv 1 1 pt. 8,729
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 8,670
  5. Avatar for mnucer 55. mnucer Lv 1 1 pt. 8,668
  6. Avatar for Larini 56. Larini Lv 1 1 pt. 8,610
  7. Avatar for abiogenesis 57. abiogenesis Lv 1 1 pt. 8,564
  8. Avatar for Wiz kid 58. Wiz kid Lv 1 1 pt. 8,556
  9. Avatar for TgamesPi 59. TgamesPi Lv 1 1 pt. 8,555
  10. Avatar for Trajan464 60. Trajan464 Lv 1 1 pt. 8,364

Comments