Icon representing a puzzle

2337: Revisiting Puzzle 90: Heliomicin

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for NKSA 11. NKSA 1 pt. 7,520
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0

  1. Avatar for LaundryBot 71. LaundryBot Lv 1 1 pt. 6,271
  2. Avatar for lucianobrito 72. lucianobrito Lv 1 1 pt. 1,532
  3. Avatar for agcohn821 73. agcohn821 Lv 1 1 pt. 0
  4. Avatar for acf 74. acf Lv 1 1 pt. 0

Comments