Placeholder image of a protein
Icon representing a puzzle

2341: Electron Density Reconstruction 53

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
August 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the protein chain in the puzzle.

Sequence
RLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 30,084

  1. Avatar for rosie4loop 21. rosie4loop Lv 1 17 pts. 32,476
  2. Avatar for ichwilldiesennamen 22. ichwilldiesennamen Lv 1 15 pts. 32,466
  3. Avatar for phi16 23. phi16 Lv 1 14 pts. 32,403
  4. Avatar for Bletchley Park 24. Bletchley Park Lv 1 12 pts. 32,400
  5. Avatar for alcor29 25. alcor29 Lv 1 11 pts. 32,390
  6. Avatar for BackBuffer 26. BackBuffer Lv 1 10 pts. 32,378
  7. Avatar for NPrincipi 27. NPrincipi Lv 1 9 pts. 32,372
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 8 pts. 32,360
  9. Avatar for Gonegirl 29. Gonegirl Lv 1 7 pts. 32,358
  10. Avatar for Simek 30. Simek Lv 1 6 pts. 32,322

Comments


rosie4loop Lv 1

Depends on purpose i think.

Generally crystallographers would either leave a gap between if the residue is competely disordered (instead of linking adjacent residues) or if the backbone is somehow resolved model it as alanine.

Because if it's not there at all and you force it in the map it can lead to a kind of bias and poor model correlation.

Since there's a big blob of green maps there (unmodelled densities) when contoured at 3 sigma which overlap the backbone (blue map typically contoured at 1 sigma, green and red 3 sigma) maybe better add it back. If have time maybe can put it back and recalculate the map to see if there's any red maps there, if no it should be there.

But I guess even if there's no green map, if you model it there first for a better fitting of other residues, and remove them before recalculation of the map maybe it can be useful, I am not sure. I'm still new to x-ray structure solution.

For computational chemists usually we need to manually add back these residues before we do simulation or virtual screening (if the missing region is within the targeted site). Still really depends on purpose.

(Edit: fix typos)

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2341: Electron Density Reconstruction 53
2  puckers found!
pucker 1 (ideality), segments 49-50 (protein), distance = 5.589, ideality = -1721.693, -1723.598
pucker 2 (ideality), segments 150-151 (protein), distance = 7.741, ideality = -7825.07, -7827.094