Placeholder image of a protein
Icon representing a puzzle

2341: Electron Density Reconstruction 53

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
August 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the protein chain in the puzzle.

Sequence
RLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 30,084

  1. Avatar for B. A. Beder 61. B. A. Beder Lv 1 1 pt. 29,969
  2. Avatar for Math13 62. Math13 Lv 1 1 pt. 29,968
  3. Avatar for Deleted player 63. Deleted player 1 pt. 29,925
  4. Avatar for Belle36 64. Belle36 Lv 1 1 pt. 29,647
  5. Avatar for deathbat_87 65. deathbat_87 Lv 1 1 pt. 29,614
  6. Avatar for mohammadrezasafi 66. mohammadrezasafi Lv 1 1 pt. 25,585
  7. Avatar for hada 67. hada Lv 1 1 pt. 4,529
  8. Avatar for Gematron 2874 68. Gematron 2874 Lv 1 1 pt. 4,529

Comments


rosie4loop Lv 1

Depends on purpose i think.

Generally crystallographers would either leave a gap between if the residue is competely disordered (instead of linking adjacent residues) or if the backbone is somehow resolved model it as alanine.

Because if it's not there at all and you force it in the map it can lead to a kind of bias and poor model correlation.

Since there's a big blob of green maps there (unmodelled densities) when contoured at 3 sigma which overlap the backbone (blue map typically contoured at 1 sigma, green and red 3 sigma) maybe better add it back. If have time maybe can put it back and recalculate the map to see if there's any red maps there, if no it should be there.

But I guess even if there's no green map, if you model it there first for a better fitting of other residues, and remove them before recalculation of the map maybe it can be useful, I am not sure. I'm still new to x-ray structure solution.

For computational chemists usually we need to manually add back these residues before we do simulation or virtual screening (if the missing region is within the targeted site). Still really depends on purpose.

(Edit: fix typos)

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2341: Electron Density Reconstruction 53
2  puckers found!
pucker 1 (ideality), segments 49-50 (protein), distance = 5.589, ideality = -1721.693, -1723.598
pucker 2 (ideality), segments 150-151 (protein), distance = 7.741, ideality = -7825.07, -7827.094