Placeholder image of a protein
Icon representing a puzzle

2341: Electron Density Reconstruction 53

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the protein chain in the puzzle.

Sequence
RLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED

Top groups


  1. Avatar for Contenders 100 pts. 32,756
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 32,746
  3. Avatar for Go Science 3. Go Science 33 pts. 32,717
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 32,624
  5. Avatar for Australia 5. Australia 8 pts. 32,548
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 32,485
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 32,360
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 32,322
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 32,165
  10. Avatar for VeFold 10. VeFold 1 pt. 32,165

  1. Avatar for MicElephant
    1. MicElephant Lv 1
    100 pts. 32,756
  2. Avatar for guineapig 2. guineapig Lv 1 56 pts. 32,753
  3. Avatar for Galaxie 3. Galaxie Lv 1 29 pts. 32,746
  4. Avatar for maithra 4. maithra Lv 1 14 pts. 32,719
  5. Avatar for LociOiling 5. LociOiling Lv 1 6 pts. 32,719
  6. Avatar for phi16 6. phi16 Lv 1 2 pts. 32,683
  7. Avatar for alcor29 7. alcor29 Lv 1 1 pt. 32,576
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 1 pt. 32,562
  9. Avatar for Oransche 10. Oransche Lv 1 1 pt. 31,456

Comments


rosie4loop Lv 1

Depends on purpose i think.

Generally crystallographers would either leave a gap between if the residue is competely disordered (instead of linking adjacent residues) or if the backbone is somehow resolved model it as alanine.

Because if it's not there at all and you force it in the map it can lead to a kind of bias and poor model correlation.

Since there's a big blob of green maps there (unmodelled densities) when contoured at 3 sigma which overlap the backbone (blue map typically contoured at 1 sigma, green and red 3 sigma) maybe better add it back. If have time maybe can put it back and recalculate the map to see if there's any red maps there, if no it should be there.

But I guess even if there's no green map, if you model it there first for a better fitting of other residues, and remove them before recalculation of the map maybe it can be useful, I am not sure. I'm still new to x-ray structure solution.

For computational chemists usually we need to manually add back these residues before we do simulation or virtual screening (if the missing region is within the targeted site). Still really depends on purpose.

(Edit: fix typos)

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2341: Electron Density Reconstruction 53
2  puckers found!
pucker 1 (ideality), segments 49-50 (protein), distance = 5.589, ideality = -1721.693, -1723.598
pucker 2 (ideality), segments 150-151 (protein), distance = 7.741, ideality = -7825.07, -7827.094