Placeholder image of a protein
Icon representing a puzzle

2341: Electron Density Reconstruction 53

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
August 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the protein chain in the puzzle.

Sequence
RLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED

Top groups


  1. Avatar for Contenders 100 pts. 32,756
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 32,746
  3. Avatar for Go Science 3. Go Science 33 pts. 32,717
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 32,624
  5. Avatar for Australia 5. Australia 8 pts. 32,548
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 32,485
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 32,360
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 32,322
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 32,165
  10. Avatar for VeFold 10. VeFold 1 pt. 32,165

  1. Avatar for nicobul 31. nicobul Lv 1 5 pts. 32,321
  2. Avatar for hansvandenhof 32. hansvandenhof Lv 1 5 pts. 32,231
  3. Avatar for ucad 33. ucad Lv 1 4 pts. 32,221
  4. Avatar for Wiz kid 34. Wiz kid Lv 1 4 pts. 32,190
  5. Avatar for Trajan464 35. Trajan464 Lv 1 3 pts. 32,180
  6. Avatar for AlphaFold2 36. AlphaFold2 Lv 1 3 pts. 32,165
  7. Avatar for Hillbillie 37. Hillbillie Lv 1 2 pts. 32,144
  8. Avatar for Anfinsen_slept_here 38. Anfinsen_slept_here Lv 1 2 pts. 32,136
  9. Avatar for Oransche 39. Oransche Lv 1 2 pts. 32,072
  10. Avatar for Artoria2e5 40. Artoria2e5 Lv 1 2 pts. 31,991

Comments


rosie4loop Lv 1

Depends on purpose i think.

Generally crystallographers would either leave a gap between if the residue is competely disordered (instead of linking adjacent residues) or if the backbone is somehow resolved model it as alanine.

Because if it's not there at all and you force it in the map it can lead to a kind of bias and poor model correlation.

Since there's a big blob of green maps there (unmodelled densities) when contoured at 3 sigma which overlap the backbone (blue map typically contoured at 1 sigma, green and red 3 sigma) maybe better add it back. If have time maybe can put it back and recalculate the map to see if there's any red maps there, if no it should be there.

But I guess even if there's no green map, if you model it there first for a better fitting of other residues, and remove them before recalculation of the map maybe it can be useful, I am not sure. I'm still new to x-ray structure solution.

For computational chemists usually we need to manually add back these residues before we do simulation or virtual screening (if the missing region is within the targeted site). Still really depends on purpose.

(Edit: fix typos)

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2341: Electron Density Reconstruction 53
2  puckers found!
pucker 1 (ideality), segments 49-50 (protein), distance = 5.589, ideality = -1721.693, -1723.598
pucker 2 (ideality), segments 150-151 (protein), distance = 7.741, ideality = -7825.07, -7827.094