Icon representing a puzzle

2346: Revisiting Puzzle 93: Spider Toxin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 7,760
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 7,580
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,381
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,990
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 94 pts. 9,951
  3. Avatar for blazegeek 3. blazegeek Lv 1 88 pts. 9,891
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 82 pts. 9,858
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 77 pts. 9,857
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 72 pts. 9,822
  7. Avatar for MicElephant 7. MicElephant Lv 1 67 pts. 9,821
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 62 pts. 9,812
  9. Avatar for gmn 9. gmn Lv 1 58 pts. 9,811
  10. Avatar for AlkiP0Ps 10. AlkiP0Ps Lv 1 54 pts. 9,771

Comments