Icon representing a puzzle

2346: Revisiting Puzzle 93: Spider Toxin

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,990
  2. Avatar for Go Science 2. Go Science 65 pts. 9,858
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 9,857
  4. Avatar for Contenders 4. Contenders 24 pts. 9,821
  5. Avatar for Australia 5. Australia 14 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 9,538
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 9,527
  8. Avatar for VeFold 8. VeFold 2 pts. 9,508
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,431
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,055

  1. Avatar for Dr.Sillem 41. Dr.Sillem Lv 1 3 pts. 8,705
  2. Avatar for carxo 42. carxo Lv 1 3 pts. 8,702
  3. Avatar for abiogenesis 43. abiogenesis Lv 1 2 pts. 8,700
  4. Avatar for Alistair69 44. Alistair69 Lv 1 2 pts. 8,676
  5. Avatar for NPrincipi 45. NPrincipi Lv 1 2 pts. 8,670
  6. Avatar for Docilya 46. Docilya Lv 1 2 pts. 8,644
  7. Avatar for Larini 47. Larini Lv 1 1 pt. 8,622
  8. Avatar for Deleted player 48. Deleted player 1 pt. 8,520
  9. Avatar for svman 49. svman Lv 1 1 pt. 8,484
  10. Avatar for Steven Pletsch 50. Steven Pletsch Lv 1 1 pt. 8,453

Comments