Icon representing a puzzle

2346: Revisiting Puzzle 93: Spider Toxin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,990
  2. Avatar for Go Science 2. Go Science 65 pts. 9,858
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 9,857
  4. Avatar for Contenders 4. Contenders 24 pts. 9,821
  5. Avatar for Australia 5. Australia 14 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 9,538
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 9,527
  8. Avatar for VeFold 8. VeFold 2 pts. 9,508
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,431
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,055
  1. Avatar for Just_A_Nerd 61. Just_A_Nerd Lv 1 1 pt. 7,747
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 7,642
  3. Avatar for AlphaFold2 63. AlphaFold2 Lv 1 1 pt. 7,580
  4. Avatar for ucad 64. ucad Lv 1 1 pt. 7,529
  5. Avatar for Fboar 65. Fboar Lv 1 1 pt. 7,475
  6. Avatar for andrewgood 66. andrewgood Lv 1 1 pt. 7,381
  7. Avatar for anasaf 67. anasaf Lv 1 1 pt. 7,286
  8. Avatar for Mohoernchen 68. Mohoernchen Lv 1 1 pt. 7,210
  9. Avatar for ostrichlittledungeon 69. ostrichlittledungeon Lv 1 1 pt. 7,110
  10. Avatar for Matia 70. Matia Lv 1 1 pt. 7,003

Comments