Icon representing a puzzle

2352: Revisiting Puzzle 95: Chicken

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,999
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,776
  3. Avatar for Belgium 13. Belgium 1 pt. 9,484
  4. Avatar for For Draft 15. For Draft 1 pt. 8,914
  5. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,553

  1. Avatar for rdog2934 91. rdog2934 Lv 1 1 pt. 2,862
  2. Avatar for DCSCDCT 92. DCSCDCT Lv 1 1 pt. 2,862
  3. Avatar for phi16 93. phi16 Lv 1 1 pt. 2,862

Comments