Icon representing a puzzle

2352: Revisiting Puzzle 95: Chicken

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,999
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,776
  3. Avatar for Belgium 13. Belgium 1 pt. 9,484
  4. Avatar for For Draft 15. For Draft 1 pt. 8,914
  5. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,553

  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 57 pts. 10,607
  2. Avatar for MicElephant 12. MicElephant Lv 1 53 pts. 10,601
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 50 pts. 10,596
  4. Avatar for silent gene 14. silent gene Lv 1 47 pts. 10,587
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 44 pts. 10,571
  6. Avatar for ichwilldiesennamen 16. ichwilldiesennamen Lv 1 42 pts. 10,541
  7. Avatar for hansvandenhof 17. hansvandenhof Lv 1 39 pts. 10,539
  8. Avatar for Sandrix72 18. Sandrix72 Lv 1 37 pts. 10,529
  9. Avatar for georg137 19. georg137 Lv 1 34 pts. 10,496
  10. Avatar for akaaka 20. akaaka Lv 1 32 pts. 10,489

Comments