Icon representing a puzzle

2352: Revisiting Puzzle 95: Chicken

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,999
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,776
  3. Avatar for Belgium 13. Belgium 1 pt. 9,484
  4. Avatar for For Draft 15. For Draft 1 pt. 8,914
  5. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,553

  1. Avatar for heyubob 51. heyubob Lv 1 2 pts. 9,776
  2. Avatar for pfirth 52. pfirth Lv 1 2 pts. 9,726
  3. Avatar for Joanna_H 53. Joanna_H Lv 1 2 pts. 9,690
  4. Avatar for Trajan464 54. Trajan464 Lv 1 2 pts. 9,680
  5. Avatar for DScott 55. DScott Lv 1 2 pts. 9,671
  6. Avatar for yutakko 56. yutakko Lv 1 2 pts. 9,643
  7. Avatar for CAN1958 57. CAN1958 Lv 1 1 pt. 9,583
  8. Avatar for Oransche 58. Oransche Lv 1 1 pt. 9,538
  9. Avatar for koolcoder101 59. koolcoder101 Lv 1 1 pt. 9,523
  10. Avatar for ivalnic123 60. ivalnic123 Lv 1 1 pt. 9,495

Comments