Icon representing a puzzle

2352: Revisiting Puzzle 95: Chicken

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,999
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,776
  3. Avatar for Belgium 13. Belgium 1 pt. 9,484
  4. Avatar for For Draft 15. For Draft 1 pt. 8,914
  5. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,553

  1. Avatar for Nadohoi 71. Nadohoi Lv 1 1 pt. 9,190
  2. Avatar for Christopher626 72. Christopher626 Lv 1 1 pt. 9,161
  3. Avatar for Pietro 73. Pietro Lv 1 1 pt. 9,161
  4. Avatar for jdmclure 74. jdmclure Lv 1 1 pt. 9,129
  5. Avatar for Peskyferret 75. Peskyferret Lv 1 1 pt. 9,119
  6. Avatar for The Nephrons 76. The Nephrons Lv 1 1 pt. 9,039
  7. Avatar for lexigutierrezz 77. lexigutierrezz Lv 1 1 pt. 9,034
  8. Avatar for Swapper242 78. Swapper242 Lv 1 1 pt. 9,017
  9. Avatar for nickghost 79. nickghost Lv 1 1 pt. 8,975
  10. Avatar for Reinne 80. Reinne Lv 1 1 pt. 8,914

Comments