Icon representing a puzzle

2352: Revisiting Puzzle 95: Chicken

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,999
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 9,776
  3. Avatar for Belgium 13. Belgium 1 pt. 9,484
  4. Avatar for For Draft 15. For Draft 1 pt. 8,914
  5. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,553

  1. Avatar for furi0us 81. furi0us Lv 1 1 pt. 8,901
  2. Avatar for foldshark 82. foldshark Lv 1 1 pt. 8,818
  3. Avatar for AlphaFold2 83. AlphaFold2 Lv 1 1 pt. 8,553
  4. Avatar for Combofrz_ 84. Combofrz_ Lv 1 1 pt. 8,434
  5. Avatar for shadowfrog 85. shadowfrog Lv 1 1 pt. 8,395
  6. Avatar for Iwillsob 86. Iwillsob Lv 1 1 pt. 8,382
  7. Avatar for Phoenix38 87. Phoenix38 Lv 1 1 pt. 8,271
  8. Avatar for sebastiaanwest 88. sebastiaanwest Lv 1 1 pt. 7,901
  9. Avatar for sheryldavid 89. sheryldavid Lv 1 1 pt. 5,821
  10. Avatar for connaeTH 90. connaeTH Lv 1 1 pt. 3,151

Comments