Placeholder image of a protein
Icon representing a puzzle

2344: Electron Density Reconstruction 54 (Trim tool recommended)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
August 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a big protein chain and then two smaller protein chains as well. Also, it's pretty gigantic, so the Trim Tool is highly recommended.

Sequence
KKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWGRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKL TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK ETFSKIRVKPEHVIGVTVAFVIIEAILTYGRF

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 0

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 50,511
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 93 pts. 50,309
  3. Avatar for blazegeek 3. blazegeek Lv 1 86 pts. 50,139
  4. Avatar for LociOiling 4. LociOiling Lv 1 79 pts. 50,062
  5. Avatar for Galaxie 5. Galaxie Lv 1 73 pts. 50,012
  6. Avatar for gmn 6. gmn Lv 1 67 pts. 49,828
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 61 pts. 49,739
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 56 pts. 49,666
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 51 pts. 49,629
  10. Avatar for BackBuffer 10. BackBuffer Lv 1 47 pts. 49,589

Comments


Artoria2e5 Lv 1

This is the SecYEG translocon of Methanocaldococcus jannaschii. There are multiple PDB structures of this complex and I don't know which one this is.

AA Edit dumps

>A
kklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwgrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcfveavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsqtifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgrikgavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayylstpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrigslgmaikgfrksekaiehrlkryippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllrekvselhpaiakl
>B
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyikgilk
>C
etfskirvkpehvigvtvafviieailtygrf

Blasting A gives an exact match at 2YXQ, which has no unmodelled residues in-between. Good!

Oh, and don't worry too much about burials. A good chunk of this thing sits in a lipid membrane.