Placeholder image of a protein
Icon representing a puzzle

2344: Electron Density Reconstruction 54 (Trim tool recommended)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
August 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a big protein chain and then two smaller protein chains as well. Also, it's pretty gigantic, so the Trim Tool is highly recommended.

Sequence
KKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWGRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKL TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK ETFSKIRVKPEHVIGVTVAFVIIEAILTYGRF

Top groups


  1. Avatar for Go Science 100 pts. 50,511
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 50,062
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 49,739
  4. Avatar for Contenders 4. Contenders 17 pts. 49,540
  5. Avatar for Australia 5. Australia 8 pts. 48,792
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 4 pts. 48,644
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 47,567
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 46,234
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 44,878
  10. Avatar for VeFold 10. VeFold 1 pt. 44,555

  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 43 pts. 49,540
  2. Avatar for NPrincipi 12. NPrincipi Lv 1 39 pts. 49,533
  3. Avatar for grogar7 13. grogar7 Lv 1 35 pts. 49,256
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 32 pts. 49,227
  5. Avatar for phi16 15. phi16 Lv 1 29 pts. 49,006
  6. Avatar for silent gene 16. silent gene Lv 1 26 pts. 48,999
  7. Avatar for ichwilldiesennamen 17. ichwilldiesennamen Lv 1 24 pts. 48,873
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 21 pts. 48,792
  9. Avatar for alcor29 19. alcor29 Lv 1 19 pts. 48,778
  10. Avatar for Steven Pletsch 20. Steven Pletsch Lv 1 17 pts. 48,680

Comments


Artoria2e5 Lv 1

This is the SecYEG translocon of Methanocaldococcus jannaschii. There are multiple PDB structures of this complex and I don't know which one this is.

AA Edit dumps

>A
kklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwgrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcfveavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsqtifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgrikgavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayylstpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrigslgmaikgfrksekaiehrlkryippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllrekvselhpaiakl
>B
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyikgilk
>C
etfskirvkpehvigvtvafviieailtygrf

Blasting A gives an exact match at 2YXQ, which has no unmodelled residues in-between. Good!

Oh, and don't worry too much about burials. A good chunk of this thing sits in a lipid membrane.