Placeholder image of a protein
Icon representing a puzzle

2347: Electron Density Reconstruction 55

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 25, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 16,259
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 16,257
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 17,783
  2. Avatar for Galaxie 2. Galaxie Lv 1 93 pts. 17,777
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 86 pts. 17,774
  4. Avatar for gmn 4. gmn Lv 1 79 pts. 17,768
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 73 pts. 17,767
  6. Avatar for grogar7 6. grogar7 Lv 1 68 pts. 17,767
  7. Avatar for MicElephant 7. MicElephant Lv 1 62 pts. 17,764
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 57 pts. 17,761
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 52 pts. 17,760
  10. Avatar for blazegeek 10. blazegeek Lv 1 48 pts. 17,756

Comments

Artoria2e5 Lv 1

This looks like PDB 3T4R. You may find some unexpectedly chunky density around M39 (PDB# A 41) and M64 (PDB# A 66); that's because the original crystal uses selenomethionine, which replaces the S with Se. The bunch of H at the end is not part of the native sequence, but a His-tag.