Placeholder image of a protein
Icon representing a puzzle

2347: Electron Density Reconstruction 55

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
August 25, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 17,783
  2. Avatar for Go Science 2. Go Science 63 pts. 17,774
  3. Avatar for Contenders 3. Contenders 37 pts. 17,764
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 17,760
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 17,740
  6. Avatar for Australia 6. Australia 5 pts. 17,725
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 17,705
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 17,668
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 17,523
  10. Avatar for VeFold 10. VeFold 1 pt. 17,523

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 17,781
  2. Avatar for LociOiling 2. LociOiling Lv 1 41 pts. 17,777
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 14 pts. 17,767
  4. Avatar for phi16 4. phi16 Lv 1 4 pts. 17,748
  5. Avatar for gmn 5. gmn Lv 1 1 pt. 17,746
  6. Avatar for alcor29 6. alcor29 Lv 1 1 pt. 17,738
  7. Avatar for silent gene 7. silent gene Lv 1 1 pt. 17,736

Comments


Artoria2e5 Lv 1

This looks like PDB 3T4R. You may find some unexpectedly chunky density around M39 (PDB# A 41) and M64 (PDB# A 66); that's because the original crystal uses selenomethionine, which replaces the S with Se. The bunch of H at the end is not part of the native sequence, but a His-tag.