Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups


  1. Avatar for Belgium 11. Belgium 1 pt. 23,183
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 22,509
  3. Avatar for VeFold 13. VeFold 1 pt. 22,509
  4. Avatar for BiOHS18 14. BiOHS18 1 pt. 15,835
  5. Avatar for Cancer Blasters! 15. Cancer Blasters! 1 pt. 15,600

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 23,683
  2. Avatar for Galaxie 2. Galaxie Lv 1 60 pts. 23,682
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 33 pts. 23,662
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 17 pts. 23,661
  5. Avatar for hansvandenhof 5. hansvandenhof Lv 1 8 pts. 23,615
  6. Avatar for alcor29 6. alcor29 Lv 1 4 pts. 23,615
  7. Avatar for jausmh 7. jausmh Lv 1 2 pts. 23,537
  8. Avatar for silent gene 8. silent gene Lv 1 1 pt. 23,515
  9. Avatar for Oransche 9. Oransche Lv 1 1 pt. 23,443
  10. Avatar for georg137 10. georg137 Lv 1 1 pt. 23,346

Comments