Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups


  1. Avatar for Belgium 11. Belgium 1 pt. 23,183
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 22,509
  3. Avatar for VeFold 13. VeFold 1 pt. 22,509
  4. Avatar for BiOHS18 14. BiOHS18 1 pt. 15,835
  5. Avatar for Cancer Blasters! 15. Cancer Blasters! 1 pt. 15,600

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 23,684
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 23,665
  3. Avatar for Galaxie 3. Galaxie Lv 1 88 pts. 23,650
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 82 pts. 23,633
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 76 pts. 23,629
  6. Avatar for blazegeek 6. blazegeek Lv 1 71 pts. 23,621
  7. Avatar for MicElephant 7. MicElephant Lv 1 66 pts. 23,598
  8. Avatar for BackBuffer 8. BackBuffer Lv 1 61 pts. 23,596
  9. Avatar for phi16 9. phi16 Lv 1 57 pts. 23,596
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 53 pts. 23,582

Comments