Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 23,183
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 22,509
  3. Avatar for VeFold 13. VeFold 1 pt. 22,509
  4. Avatar for BiOHS18 14. BiOHS18 1 pt. 15,835
  5. Avatar for Cancer Blasters! 15. Cancer Blasters! 1 pt. 15,600
  1. Avatar for Joanna_H 21. Joanna_H Lv 1 21 pts. 23,478
  2. Avatar for guineapig 22. guineapig Lv 1 19 pts. 23,472
  3. Avatar for AlkiP0Ps 23. AlkiP0Ps Lv 1 18 pts. 23,463
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 16 pts. 23,448
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 15 pts. 23,431
  6. Avatar for rosie4loop 26. rosie4loop Lv 1 13 pts. 23,404
  7. Avatar for silent gene 27. silent gene Lv 1 12 pts. 23,364
  8. Avatar for alcor29 28. alcor29 Lv 1 11 pts. 23,342
  9. Avatar for AmphotericinB 29. AmphotericinB Lv 1 10 pts. 23,333
  10. Avatar for akaaka 30. akaaka Lv 1 9 pts. 23,280

Comments