Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 23,183
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 22,509
  3. Avatar for VeFold 13. VeFold 1 pt. 22,509
  4. Avatar for BiOHS18 14. BiOHS18 1 pt. 15,835
  5. Avatar for Cancer Blasters! 15. Cancer Blasters! 1 pt. 15,600
  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 8 pts. 23,268
  2. Avatar for Artoria2e5 32. Artoria2e5 Lv 1 7 pts. 23,244
  3. Avatar for MirsadaH 33. MirsadaH Lv 1 6 pts. 23,220
  4. Avatar for georg137 34. georg137 Lv 1 6 pts. 23,205
  5. Avatar for ShadowTactics 35. ShadowTactics Lv 1 5 pts. 23,194
  6. Avatar for Deleted player 36. Deleted player 5 pts. 23,183
  7. Avatar for Gonegirl 37. Gonegirl Lv 1 5 pts. 23,134
  8. Avatar for maithra 38. maithra Lv 1 4 pts. 23,107
  9. Avatar for Oransche 39. Oransche Lv 1 4 pts. 23,090
  10. Avatar for Alistair69 40. Alistair69 Lv 1 3 pts. 23,041

Comments