Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 23,183
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 22,509
  3. Avatar for VeFold 13. VeFold 1 pt. 22,509
  4. Avatar for BiOHS18 14. BiOHS18 1 pt. 15,835
  5. Avatar for Cancer Blasters! 15. Cancer Blasters! 1 pt. 15,600
  1. Avatar for matttttttttttttttttttttttttttttttttt 71. matttttttttttttttttttttttttttttttttt Lv 1 1 pt. 21,982
  2. Avatar for StewartBiOHS 72. StewartBiOHS Lv 1 1 pt. 15,835
  3. Avatar for spvincent 73. spvincent Lv 1 1 pt. 15,600
  4. Avatar for Guido 74. Guido Lv 1 1 pt. 15,600
  5. Avatar for DCSCDCT 75. DCSCDCT Lv 1 1 pt. 15,600
  6. Avatar for KMnO4 76. KMnO4 Lv 1 1 pt. 15,600

Comments