Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups


  1. Avatar for FamilyBarmettler 11. FamilyBarmettler 1 pt. 17,390
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 17,343
  3. Avatar for Belgium 13. Belgium 1 pt. 17,150

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 17,548
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 17,546
  3. Avatar for MicElephant 3. MicElephant Lv 1 87 pts. 17,539
  4. Avatar for Galaxie 4. Galaxie Lv 1 81 pts. 17,538
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 75 pts. 17,532
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 69 pts. 17,528
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 64 pts. 17,526
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 59 pts. 17,526
  9. Avatar for BackBuffer 9. BackBuffer Lv 1 55 pts. 17,521
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 50 pts. 17,515

Comments