Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 17,548
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 17,546
  3. Avatar for Contenders 3. Contenders 41 pts. 17,539
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 17,526
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 17,505
  6. Avatar for Australia 6. Australia 7 pts. 17,498
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 17,488
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 17,460
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 17,393
  10. Avatar for VeFold 10. VeFold 1 pt. 17,393
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 17,546
  2. Avatar for LociOiling 2. LociOiling Lv 1 68 pts. 17,545
  3. Avatar for Galaxie 3. Galaxie Lv 1 44 pts. 17,545
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 27 pts. 17,541
  5. Avatar for MicElephant 5. MicElephant Lv 1 16 pts. 17,536
  6. Avatar for guineapig 6. guineapig Lv 1 9 pts. 17,535
  7. Avatar for georg137 7. georg137 Lv 1 5 pts. 17,509
  8. Avatar for alcor29 8. alcor29 Lv 1 3 pts. 17,508
  9. Avatar for maithra 9. maithra Lv 1 1 pt. 17,484
  10. Avatar for silent gene 10. silent gene Lv 1 1 pt. 17,484

Comments