Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups


  1. Avatar for Go Science 100 pts. 17,548
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 17,546
  3. Avatar for Contenders 3. Contenders 41 pts. 17,539
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 17,526
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 17,505
  6. Avatar for Australia 6. Australia 7 pts. 17,498
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 17,488
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 17,460
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 17,393
  10. Avatar for VeFold 10. VeFold 1 pt. 17,393

  1. Avatar for Swapper242 61. Swapper242 Lv 1 1 pt. 17,007
  2. Avatar for osc 62. osc Lv 1 1 pt. 16,971
  3. Avatar for furi0us 63. furi0us Lv 1 1 pt. 16,944
  4. Avatar for rinze 64. rinze Lv 1 1 pt. 16,940
  5. Avatar for Arne Heessels 65. Arne Heessels Lv 1 1 pt. 16,929
  6. Avatar for Yechan Kwon 66. Yechan Kwon Lv 1 1 pt. 16,919
  7. Avatar for threedylan 67. threedylan Lv 1 1 pt. 16,902
  8. Avatar for unicchi0427 68. unicchi0427 Lv 1 1 pt. 16,737
  9. Avatar for blablasusu 69. blablasusu Lv 1 1 pt. 16,567
  10. Avatar for Gonegirl 70. Gonegirl Lv 1 1 pt. 14,181

Comments