Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 23,718
  2. Avatar for Belgium 12. Belgium 1 pt. 23,619
  3. Avatar for BC125 - G9 13. BC125 - G9 1 pt. 23,040
  4. Avatar for Carillo's Folderz 14. Carillo's Folderz 1 pt. 22,997
  5. Avatar for BC125G1 15. BC125G1 1 pt. 22,968
  6. Avatar for BinaryStar 16. BinaryStar 1 pt. 22,917
  7. Avatar for AlphaFold 17. AlphaFold 1 pt. 22,534
  8. Avatar for UPJ Biochem 25 18. UPJ Biochem 25 1 pt. 16,036
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 24,252
  2. Avatar for LociOiling 2. LociOiling Lv 1 60 pts. 24,219
  3. Avatar for phi16 3. phi16 Lv 1 33 pts. 24,210
  4. Avatar for hansvandenhof 4. hansvandenhof Lv 1 17 pts. 24,193
  5. Avatar for alcor29 5. alcor29 Lv 1 8 pts. 24,191
  6. Avatar for MicElephant 6. MicElephant Lv 1 4 pts. 24,180
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 2 pts. 24,144
  8. Avatar for Oransche 8. Oransche Lv 1 1 pt. 24,071
  9. Avatar for silent gene 9. silent gene Lv 1 1 pt. 24,018
  10. Avatar for fpc 10. fpc Lv 1 1 pt. 23,950

Comments