Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 23,718
  2. Avatar for Belgium 12. Belgium 1 pt. 23,619
  3. Avatar for BC125 - G9 13. BC125 - G9 1 pt. 23,040
  4. Avatar for Carillo's Folderz 14. Carillo's Folderz 1 pt. 22,997
  5. Avatar for BC125G1 15. BC125G1 1 pt. 22,968
  6. Avatar for BinaryStar 16. BinaryStar 1 pt. 22,917
  7. Avatar for AlphaFold 17. AlphaFold 1 pt. 22,534
  8. Avatar for UPJ Biochem 25 18. UPJ Biochem 25 1 pt. 16,036

  1. Avatar for MirsadaH 41. MirsadaH Lv 1 5 pts. 23,718
  2. Avatar for Trajan464 42. Trajan464 Lv 1 4 pts. 23,717
  3. Avatar for Alistair69 43. Alistair69 Lv 1 4 pts. 23,696
  4. Avatar for zbp 44. zbp Lv 1 3 pts. 23,654
  5. Avatar for mengzach 45. mengzach Lv 1 3 pts. 23,648
  6. Avatar for Deleted player 46. Deleted player 3 pts. 23,619
  7. Avatar for Oransche 47. Oransche Lv 1 3 pts. 23,589
  8. Avatar for pfirth 48. pfirth Lv 1 3 pts. 23,435
  9. Avatar for maithra 49. maithra Lv 1 2 pts. 23,400
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 2 pts. 23,375

Comments