Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 23,718
  2. Avatar for Belgium 12. Belgium 1 pt. 23,619
  3. Avatar for BC125 - G9 13. BC125 - G9 1 pt. 23,040
  4. Avatar for Carillo's Folderz 14. Carillo's Folderz 1 pt. 22,997
  5. Avatar for BC125G1 15. BC125G1 1 pt. 22,968
  6. Avatar for BinaryStar 16. BinaryStar 1 pt. 22,917
  7. Avatar for AlphaFold 17. AlphaFold 1 pt. 22,534
  8. Avatar for UPJ Biochem 25 18. UPJ Biochem 25 1 pt. 16,036
  1. Avatar for AlphaFold2 81. AlphaFold2 Lv 1 1 pt. 22,534
  2. Avatar for Yechan Kwon 82. Yechan Kwon Lv 1 1 pt. 22,526
  3. Avatar for meycen 83. meycen Lv 1 1 pt. 21,720
  4. Avatar for deathbat_87 84. deathbat_87 Lv 1 1 pt. 19,829
  5. Avatar for xiaopeng 85. xiaopeng Lv 1 1 pt. 16,073
  6. Avatar for kiwileo 86. kiwileo Lv 1 1 pt. 16,036
  7. Avatar for guebr23 87. guebr23 Lv 1 1 pt. 16,036

Comments