Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 24,252
  2. Avatar for Go Science 2. Go Science 74 pts. 24,204
  3. Avatar for Contenders 3. Contenders 54 pts. 24,182
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 24,156
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 24,084
  6. Avatar for Australia 6. Australia 18 pts. 24,003
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 12 pts. 23,971
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 23,839
  9. Avatar for VeFold 9. VeFold 5 pts. 23,833
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 23,736
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 24,252
  2. Avatar for LociOiling 2. LociOiling Lv 1 60 pts. 24,219
  3. Avatar for phi16 3. phi16 Lv 1 33 pts. 24,210
  4. Avatar for hansvandenhof 4. hansvandenhof Lv 1 17 pts. 24,193
  5. Avatar for alcor29 5. alcor29 Lv 1 8 pts. 24,191
  6. Avatar for MicElephant 6. MicElephant Lv 1 4 pts. 24,180
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 2 pts. 24,144
  8. Avatar for Oransche 8. Oransche Lv 1 1 pt. 24,071
  9. Avatar for silent gene 9. silent gene Lv 1 1 pt. 24,018
  10. Avatar for fpc 10. fpc Lv 1 1 pt. 23,950

Comments