Icon representing a puzzle

2364: Revisiting Puzzle 110: Turkey

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,884
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,640
  3. Avatar for Carillo's Folderz 13. Carillo's Folderz 1 pt. 9,118
  4. Avatar for BC125 - G9 14. BC125 - G9 1 pt. 8,751
  5. Avatar for Team China 15. Team China 1 pt. 8,424
  6. Avatar for BC125G1 16. BC125G1 1 pt. 7,787

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,701
  2. Avatar for LociOiling 2. LociOiling Lv 1 65 pts. 10,651
  3. Avatar for gdnskye 3. gdnskye Lv 1 41 pts. 10,634
  4. Avatar for gmn 4. gmn Lv 1 24 pts. 10,621
  5. Avatar for phi16 5. phi16 Lv 1 14 pts. 10,620
  6. Avatar for alcor29 6. alcor29 Lv 1 7 pts. 10,618
  7. Avatar for hansvandenhof 7. hansvandenhof Lv 1 4 pts. 10,616
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 2 pts. 10,539
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 1 pt. 10,532
  10. Avatar for jausmh 10. jausmh Lv 1 1 pt. 10,502

Comments