Icon representing a puzzle

2364: Revisiting Puzzle 110: Turkey

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,884
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,640
  3. Avatar for Carillo's Folderz 13. Carillo's Folderz 1 pt. 9,118
  4. Avatar for BC125 - G9 14. BC125 - G9 1 pt. 8,751
  5. Avatar for Team China 15. Team China 1 pt. 8,424
  6. Avatar for BC125G1 16. BC125G1 1 pt. 7,787
  1. Avatar for Dr.Sillem 41. Dr.Sillem Lv 1 7 pts. 9,860
  2. Avatar for heather-1 42. heather-1 Lv 1 6 pts. 9,817
  3. Avatar for ProfVince 43. ProfVince Lv 1 6 pts. 9,765
  4. Avatar for NPrincipi 44. NPrincipi Lv 1 5 pts. 9,750
  5. Avatar for maithra 45. maithra Lv 1 5 pts. 9,749
  6. Avatar for nicobul 46. nicobul Lv 1 4 pts. 9,720
  7. Avatar for DScott 47. DScott Lv 1 4 pts. 9,653
  8. Avatar for AlphaFold2 48. AlphaFold2 Lv 1 4 pts. 9,640
  9. Avatar for ucad 49. ucad Lv 1 3 pts. 9,619
  10. Avatar for pfirth 50. pfirth Lv 1 3 pts. 9,619

Comments