Icon representing a puzzle

2364: Revisiting Puzzle 110: Turkey

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,884
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,640
  3. Avatar for Carillo's Folderz 13. Carillo's Folderz 1 pt. 9,118
  4. Avatar for BC125 - G9 14. BC125 - G9 1 pt. 8,751
  5. Avatar for Team China 15. Team China 1 pt. 8,424
  6. Avatar for BC125G1 16. BC125G1 1 pt. 7,787
  1. Avatar for Oransche 61. Oransche Lv 1 1 pt. 9,272
  2. Avatar for Yechan Kwon 62. Yechan Kwon Lv 1 1 pt. 9,272
  3. Avatar for lilami 63. lilami Lv 1 1 pt. 9,214
  4. Avatar for Iriluscent 64. Iriluscent Lv 1 1 pt. 9,174
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 9,146
  6. Avatar for myaka 66. myaka Lv 1 1 pt. 9,118
  7. Avatar for osc 67. osc Lv 1 1 pt. 9,066
  8. Avatar for PrimeLemur 68. PrimeLemur Lv 1 1 pt. 9,029
  9. Avatar for NickMihal 69. NickMihal Lv 1 1 pt. 9,015
  10. Avatar for Alistair69 70. Alistair69 Lv 1 1 pt. 8,949

Comments