Icon representing a puzzle

2364: Revisiting Puzzle 110: Turkey

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,701
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 10,559
  3. Avatar for Go Science 3. Go Science 49 pts. 10,539
  4. Avatar for Contenders 4. Contenders 33 pts. 10,465
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,295
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,263
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,132
  8. Avatar for Australia 8. Australia 5 pts. 10,098
  9. Avatar for VeFold 9. VeFold 3 pts. 10,083
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,009
  1. Avatar for gmn 11. gmn Lv 1 57 pts. 10,402
  2. Avatar for Galaxie 12. Galaxie Lv 1 54 pts. 10,387
  3. Avatar for hansvandenhof 13. hansvandenhof Lv 1 51 pts. 10,387
  4. Avatar for MicElephant 14. MicElephant Lv 1 48 pts. 10,375
  5. Avatar for akaaka 15. akaaka Lv 1 45 pts. 10,375
  6. Avatar for blazegeek 16. blazegeek Lv 1 42 pts. 10,364
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 40 pts. 10,295
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 37 pts. 10,288
  9. Avatar for SemperRabbit 19. SemperRabbit Lv 1 35 pts. 10,287
  10. Avatar for Aubade01 20. Aubade01 Lv 1 33 pts. 10,281

Comments