Icon representing a puzzle

2367: Revisiting Puzzle 111: Mouse

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for FamilyBarmettler 11. FamilyBarmettler 2 pts. 9,469
  2. Avatar for Group3_BC180 12. Group3_BC180 1 pt. 9,429
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,404
  4. Avatar for AlphaFold 14. AlphaFold 1 pt. 9,303
  5. Avatar for BinaryStar 15. BinaryStar 1 pt. 9,076
  6. Avatar for Carillo's Folderz 16. Carillo's Folderz 1 pt. 9,070
  7. Avatar for BC125G1 17. BC125G1 1 pt. 8,991
  8. Avatar for BC125 G6 18. BC125 G6 1 pt. 8,150
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 58 pts. 9,769
  2. Avatar for hansvandenhof 12. hansvandenhof Lv 1 55 pts. 9,768
  3. Avatar for akaaka 13. akaaka Lv 1 51 pts. 9,765
  4. Avatar for stomjoh 14. stomjoh Lv 1 48 pts. 9,764
  5. Avatar for blazegeek 15. blazegeek Lv 1 46 pts. 9,762
  6. Avatar for Galaxie 16. Galaxie Lv 1 43 pts. 9,756
  7. Avatar for guineapig 17. guineapig Lv 1 40 pts. 9,749
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 38 pts. 9,738
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 35 pts. 9,729
  10. Avatar for fpc 20. fpc Lv 1 33 pts. 9,695

Comments