Icon representing a puzzle

2367: Revisiting Puzzle 111: Mouse

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Go Science 100 pts. 9,913
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,906
  3. Avatar for Contenders 3. Contenders 54 pts. 9,822
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 9,769
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,695
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,694
  7. Avatar for VeFold 7. VeFold 12 pts. 9,680
  8. Avatar for Australia 8. Australia 8 pts. 9,649
  9. Avatar for Czech National Team 9. Czech National Team 5 pts. 9,598
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,556

  1. Avatar for vybi 31. vybi Lv 1 15 pts. 9,598
  2. Avatar for rosie4loop 32. rosie4loop Lv 1 14 pts. 9,577
  3. Avatar for Larini 33. Larini Lv 1 13 pts. 9,573
  4. Avatar for roarshock 34. roarshock Lv 1 12 pts. 9,573
  5. Avatar for maithra 35. maithra Lv 1 11 pts. 9,570
  6. Avatar for alcor29 36. alcor29 Lv 1 11 pts. 9,568
  7. Avatar for ShadowTactics 37. ShadowTactics Lv 1 10 pts. 9,556
  8. Avatar for DScott 38. DScott Lv 1 9 pts. 9,527
  9. Avatar for Opelgang 39. Opelgang Lv 1 8 pts. 9,495
  10. Avatar for Arne Heessels 40. Arne Heessels Lv 1 8 pts. 9,493

Comments