Icon representing a puzzle

2367: Revisiting Puzzle 111: Mouse

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,913
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,906
  3. Avatar for Contenders 3. Contenders 54 pts. 9,822
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 9,769
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,695
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,694
  7. Avatar for VeFold 7. VeFold 12 pts. 9,680
  8. Avatar for Australia 8. Australia 8 pts. 9,649
  9. Avatar for Czech National Team 9. Czech National Team 5 pts. 9,598
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,556
  1. Avatar for Joanna_H 21. Joanna_H Lv 1 31 pts. 9,694
  2. Avatar for gdnskye 22. gdnskye Lv 1 29 pts. 9,680
  3. Avatar for Hillbillie 23. Hillbillie Lv 1 27 pts. 9,680
  4. Avatar for silent gene 24. silent gene Lv 1 26 pts. 9,679
  5. Avatar for georg137 25. georg137 Lv 1 24 pts. 9,676
  6. Avatar for Steven Pletsch 26. Steven Pletsch Lv 1 22 pts. 9,672
  7. Avatar for phi16 27. phi16 Lv 1 21 pts. 9,671
  8. Avatar for jausmh 28. jausmh Lv 1 19 pts. 9,669
  9. Avatar for gmn 29. gmn Lv 1 18 pts. 9,661
  10. Avatar for AlkiP0Ps 30. AlkiP0Ps Lv 1 17 pts. 9,649

Comments