Placeholder image of a protein
Icon representing a puzzle

2374: Electron Density Reconstruction 64

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
October 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 26,868
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 26,688
  3. Avatar for 202302 13. 202302 1 pt. 26,445
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 26,380
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 27,182
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 27,177
  3. Avatar for BackBuffer 3. BackBuffer Lv 1 87 pts. 27,166
  4. Avatar for Galaxie 4. Galaxie Lv 1 81 pts. 27,164
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 75 pts. 27,150
  6. Avatar for MicElephant 6. MicElephant Lv 1 70 pts. 27,150
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 64 pts. 27,135
  8. Avatar for gmn 8. gmn Lv 1 60 pts. 27,134
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 55 pts. 27,132
  10. Avatar for fpc 10. fpc Lv 1 51 pts. 27,130

Comments