Placeholder image of a protein
Icon representing a puzzle

2374: Electron Density Reconstruction 64

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
October 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 27,182
  2. Avatar for Go Science 2. Go Science 68 pts. 27,177
  3. Avatar for Contenders 3. Contenders 44 pts. 27,150
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 27,130
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 27,108
  6. Avatar for Australia 6. Australia 9 pts. 27,101
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 27,063
  8. Avatar for VeFold 8. VeFold 3 pts. 27,028
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 27,023
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 26,879

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 27,182
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 27,177
  3. Avatar for BackBuffer 3. BackBuffer Lv 1 87 pts. 27,166
  4. Avatar for Galaxie 4. Galaxie Lv 1 81 pts. 27,164
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 75 pts. 27,150
  6. Avatar for MicElephant 6. MicElephant Lv 1 70 pts. 27,150
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 64 pts. 27,135
  8. Avatar for gmn 8. gmn Lv 1 60 pts. 27,134
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 55 pts. 27,132
  10. Avatar for fpc 10. fpc Lv 1 51 pts. 27,130

Comments