Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for 202302 11. 202302 1 pt. 10,043
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,955
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,760
  4. Avatar for Belgium 14. Belgium 1 pt. 9,441
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 8,917
  6. Avatar for Window Group 16. Window Group 1 pt. 7,465
  1. Avatar for 122010101060 91. 122010101060 Lv 1 1 pt. 5,520
  2. Avatar for jeff101 92. jeff101 Lv 1 1 pt. 5,520

Comments