Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 10,008
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,491
  3. Avatar for 202302 13. 202302 1 pt. 9,305
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 8,465
  1. Avatar for heather-1 31. heather-1 Lv 1 11 pts. 10,636
  2. Avatar for ProfVince 32. ProfVince Lv 1 10 pts. 10,622
  3. Avatar for rosie4loop 33. rosie4loop Lv 1 10 pts. 10,615
  4. Avatar for alcor29 34. alcor29 Lv 1 9 pts. 10,533
  5. Avatar for Commaster 35. Commaster Lv 1 8 pts. 10,425
  6. Avatar for JackONeill12 36. JackONeill12 Lv 1 7 pts. 10,317
  7. Avatar for Steven Pletsch 37. Steven Pletsch Lv 1 7 pts. 10,306
  8. Avatar for ecali 38. ecali Lv 1 6 pts. 10,297
  9. Avatar for Oransche 39. Oransche Lv 1 5 pts. 10,197
  10. Avatar for Larini 40. Larini Lv 1 5 pts. 10,178

Comments