Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Belgium 11. Belgium 1 pt. 10,008
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,491
  3. Avatar for 202302 13. 202302 1 pt. 9,305
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 8,465

  1. Avatar for carxo 51. carxo Lv 1 2 pts. 9,747
  2. Avatar for Unc 52. Unc Lv 1 1 pt. 9,717
  3. Avatar for Karlheinz 53. Karlheinz Lv 1 1 pt. 9,705
  4. Avatar for jdmclure 54. jdmclure Lv 1 1 pt. 9,696
  5. Avatar for Trajan464 55. Trajan464 Lv 1 1 pt. 9,641
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 9,597
  7. Avatar for RichGuilmain 57. RichGuilmain Lv 1 1 pt. 9,579
  8. Avatar for Arne Heessels 58. Arne Heessels Lv 1 1 pt. 9,528
  9. Avatar for Dr.Sillem 59. Dr.Sillem Lv 1 1 pt. 9,515
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 9,495

Comments