Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 10,008
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,491
  3. Avatar for 202302 13. 202302 1 pt. 9,305
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 8,465
  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 9,157
  2. Avatar for Gonegirl 72. Gonegirl Lv 1 1 pt. 9,145
  3. Avatar for notgenious 73. notgenious Lv 1 1 pt. 9,138
  4. Avatar for Yechan Kwon 74. Yechan Kwon Lv 1 1 pt. 9,135
  5. Avatar for KWLEE 75. KWLEE Lv 1 1 pt. 9,018
  6. Avatar for cavmcloone 76. cavmcloone Lv 1 1 pt. 8,604
  7. Avatar for 122010101060 77. 122010101060 Lv 1 1 pt. 8,465
  8. Avatar for Gematron 2874 78. Gematron 2874 Lv 1 1 pt. 8,330
  9. Avatar for 122010101049 79. 122010101049 Lv 1 1 pt. 6,434
  10. Avatar for Xiaobu 80. Xiaobu Lv 1 1 pt. 6,349

Comments