Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 10,008
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,491
  3. Avatar for 202302 13. 202302 1 pt. 9,305
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 8,465
  1. Avatar for phi16 81. phi16 Lv 1 1 pt. 6,348
  2. Avatar for DOUBICN 82. DOUBICN Lv 1 1 pt. 6,348
  3. Avatar for Atrus_Homeboy 83. Atrus_Homeboy Lv 1 1 pt. 6,348
  4. Avatar for spvincent 84. spvincent Lv 1 1 pt. 6,348
  5. Avatar for SpencerJones 85. SpencerJones Lv 1 1 pt. 6,348

Comments