Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,327
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,256
  3. Avatar for Contenders 3. Contenders 44 pts. 11,255
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 11,115
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,053
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,965
  7. Avatar for Australia 7. Australia 5 pts. 10,954
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 10,926
  9. Avatar for VeFold 9. VeFold 1 pt. 10,655
  10. Avatar for Ukraine 10. Ukraine 1 pt. 10,425

  1. Avatar for AlphaFold2 61. AlphaFold2 Lv 1 1 pt. 9,491
  2. Avatar for Th1sN@me!sN0tAPun 62. Th1sN@me!sN0tAPun Lv 1 1 pt. 9,430
  3. Avatar for pruneau_44 63. pruneau_44 Lv 1 1 pt. 9,312
  4. Avatar for dy9110 64. dy9110 Lv 1 1 pt. 9,305
  5. Avatar for froschi2 65. froschi2 Lv 1 1 pt. 9,297
  6. Avatar for osc 66. osc Lv 1 1 pt. 9,288
  7. Avatar for CoconutYeah 67. CoconutYeah Lv 1 1 pt. 9,220
  8. Avatar for DipsyDoodle2016 68. DipsyDoodle2016 Lv 1 1 pt. 9,218
  9. Avatar for jpmehta 69. jpmehta Lv 1 1 pt. 9,171
  10. Avatar for THATCHEM_GUY 70. THATCHEM_GUY Lv 1 1 pt. 9,168

Comments