Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,327
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,256
  3. Avatar for Contenders 3. Contenders 44 pts. 11,255
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 11,115
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,053
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,965
  7. Avatar for Australia 7. Australia 5 pts. 10,954
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 10,926
  9. Avatar for VeFold 9. VeFold 1 pt. 10,655
  10. Avatar for Ukraine 10. Ukraine 1 pt. 10,425

  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 9,157
  2. Avatar for Gonegirl 72. Gonegirl Lv 1 1 pt. 9,145
  3. Avatar for notgenious 73. notgenious Lv 1 1 pt. 9,138
  4. Avatar for Yechan Kwon 74. Yechan Kwon Lv 1 1 pt. 9,135
  5. Avatar for KWLEE 75. KWLEE Lv 1 1 pt. 9,018
  6. Avatar for cavmcloone 76. cavmcloone Lv 1 1 pt. 8,604
  7. Avatar for 122010101060 77. 122010101060 Lv 1 1 pt. 8,465
  8. Avatar for Gematron 2874 78. Gematron 2874 Lv 1 1 pt. 8,330
  9. Avatar for 122010101049 79. 122010101049 Lv 1 1 pt. 6,434
  10. Avatar for Xiaobu 80. Xiaobu Lv 1 1 pt. 6,349

Comments