Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,582
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,479
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,462
  4. Avatar for 202302 14. 202302 1 pt. 9,348
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 9,288
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 4,127
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,790
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 9,788
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 91 pts. 9,783
  4. Avatar for Galaxie 4. Galaxie Lv 1 86 pts. 9,773
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 82 pts. 9,772
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 77 pts. 9,769
  7. Avatar for Aubade01 7. Aubade01 Lv 1 73 pts. 9,768
  8. Avatar for guineapig 8. guineapig Lv 1 70 pts. 9,764
  9. Avatar for blazegeek 9. blazegeek Lv 1 66 pts. 9,760
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 62 pts. 9,760

Comments