Icon representing a puzzle

2393: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 9,803
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,784
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,400
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,036

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,012
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 10,960
  3. Avatar for Aubade01 3. Aubade01 Lv 1 87 pts. 10,841
  4. Avatar for blazegeek 4. blazegeek Lv 1 81 pts. 10,787
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 75 pts. 10,721
  6. Avatar for BackBuffer 6. BackBuffer Lv 1 70 pts. 10,611
  7. Avatar for grogar7 7. grogar7 Lv 1 65 pts. 10,579
  8. Avatar for ichwilldiesennamen 8. ichwilldiesennamen Lv 1 60 pts. 10,576
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 56 pts. 10,558
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 51 pts. 10,553

Comments