Icon representing a puzzle

2393: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,803
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,784
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,400
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,036
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 47 pts. 10,550
  2. Avatar for Galaxie 12. Galaxie Lv 1 44 pts. 10,487
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 40 pts. 10,442
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 37 pts. 10,438
  5. Avatar for gmn 15. gmn Lv 1 34 pts. 10,418
  6. Avatar for MicElephant 16. MicElephant Lv 1 31 pts. 10,412
  7. Avatar for fpc 17. fpc Lv 1 28 pts. 10,401
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 26 pts. 10,400
  9. Avatar for roarshock 19. roarshock Lv 1 24 pts. 10,393
  10. Avatar for Opelgang 20. Opelgang Lv 1 22 pts. 10,340

Comments